LL-37 10mg
$99.00
37-residue cathelicidin peptide (hCAP18 C-terminal fragment), 10 mg per vial.
For laboratory research use only. Not for human or veterinary use. By ordering you confirm you are 18 or older and are purchasing for lawful research.
Availability: 25 in stock
- Content per vial
- 10 mg
- Vial
- 3 mL vial
- Form
- Lyophilised powder
- Unopened, long term
- −20 °C, protected from light
Bacteriostatic water for the lab
Research peptides are supplied as a lyophilised powder. Bacteriostatic water is the standard laboratory solvent for reconstituting them, and ours is independently tested. For laboratory research use only.
Description
LL-37 is a 37-amino-acid peptide corresponding to the C-terminal region of human cathelicidin (hCAP18). It is a reference compound in laboratory research on host-defence peptides.
Supplied as 10 mg of lyophilised powder in a 3 mL vial.
Research background
LL-37 is the 37-residue peptide released from the C-terminus of hCAP18, the only cathelicidin found in humans. It is positively charged and folds into an amphipathic alpha-helix in membrane environments. It is studied in research on antimicrobial peptides, peptide-membrane interactions and innate immune signalling.
Research stage: Preclinical research. LL-37 in this form is not approved for any therapeutic use.
Selected published research
- Dürr UH, Sudheendra US, Ramamoorthy A. Biochim Biophys Acta. 2006;1758(9):1408-1425. PubMed 16716248
- Vandamme D, Landuyt B, Luyten W, et al. Cell Immunol. 2012;280(1):22-35. PubMed 23246832
This section summarises the subject of published research for reference only. It does not describe the effects of this product, which is supplied for laboratory research use only and is not for human or veterinary use.
Background reading: LL-37: the human cathelicidin peptide, sequence and lab report
Specifications
| Product | LL-37 10mg |
|---|---|
| SKU | APX-LL37-10 |
| Category | Peptides |
| Content per vial | 10 mg |
| Vial | 3 mL vial |
| Form | Lyophilised powder |
| Sequence | [LL-37, 37 aa] |
| Peptide length | 37 amino acids |
| Molecular formula | C205H340N60O53 |
| Molecular weight | ≈ 4493 g/mol |
| Intended use | Laboratory research only |
Storage
| Unopened, long term | −20 °C, protected from light |
|---|---|
| Unopened, short term | 2–8 °C for up to several weeks |
| After reconstitution | 2–8 °C; record the preparation date on the vial |
| Handling | Allow the vial to reach room temperature before opening to limit moisture uptake |
General guidance only. Follow your institution’s procedures for handling research materials.
Testing & COA
Third-party analysis by Janoshik Analytical. Details below are transcribed from the report; the PDF is the authoritative copy.
| Laboratory | Janoshik Analytical |
|---|---|
| Task number | #215328 |
| Sample as recorded | LL37 10mg |
| Tests requested | LL-37 analysis |
| Result: LL-37 | 9.97 mg |
| Purity | 99.666% |
| Lab comment | Purity assessment includes peptide peaks only. |
| Batch on report | Not stated |
| Sample received | 23 Jul 2026 |
| Analysis conducted | 31 Jul 2026 |
| Verification key | CADGTYJI5DVH |
Janoshik report #215328PDFCommon questions
How much is actually in the vial?
Janoshik Analytical measured 9.97 mg LL-37 in the vial it tested (report #215328, 31 Jul 2026), at 99.666% purity. The label states 10 mg. Measured amounts vary a little from batch to batch; the full results list everything the report covers.
How do I check the lab report is genuine?
Go to janoshik.com/verify and enter the key CADGTYJI5DVH. It brings up Janoshik's own record of test #215328, so you can confirm the PDF on this page matches what the laboratory issued.
What is it reconstituted with in the lab?
LL-37 10mg is supplied as a dry, lyophilised powder. In the laboratory, lyophilised peptides are usually reconstituted with bacteriostatic water, the standard laboratory solvent, which we stock in 3mL and 10mL vials (for laboratory research use only). See the storage notes above for unopened and reconstituted vials.
How long does shipping take in Australia?
Orders are dispatched within 1 business day of payment and sent by Australia Post Express Post with tracking, which usually arrives the next business day across most of the Express Post network (allow a few extra days for regional areas). Express Post is a $15 flat rate, or free on orders of $250 or more. We ship within Australia only. See the shipping policy.
How do I pay?
By PayID or bank transfer. The payment details appear as soon as you place your order and are emailed to you as well. Your order is dispatched once the payment arrives.
Disclaimer
LL-37 10mg is supplied for in-vitro and laboratory research only. It is not intended to diagnose, treat, cure or prevent any disease, and is not registered or listed on the Australian Register of Therapeutic Goods. Descriptions on this page summarise published chemical information and do not describe effects in humans or animals.
The purchaser is responsible for safe handling, storage and disposal, and for complying with all laws that apply to them. See the full Disclaimer and Research use terms.
Reviews
There are no reviews yet.